Vergleich

Guangxitoxin-1E Europäischer Partner

ArtNr ALO-STG-200-10mg
Hersteller Alomone
CAS-Nr. 1233152-82-3
Menge 10 mg
Quantity options 0.1 mg 0.5 mg 10 mg 1 mg 50 ug 5 mg
Kategorie
Typ Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
Various KV channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
3948.7 Da
Manufacturer - Format
Lyophilized
Short description
A Potent Gating Modifier of KV2.1, KV2.2 and KV4.3 K+ Channels
Description
GxTx-1E, κ-Theraphotoxin-Pg1a, κ-TRTX-Pg1a, Guangxitoxin 1E - A Potent Gating Modifier of KV2.1, KV2.2 and KV4.3 K+ Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Potent Gating Modifier of KV2.1, KV2.2 and KV4.3 K+ Channels

PH
7, 4
UNSPSC
12352202
Origin
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Modifications
Presumed disulfide bonds between: Cys4-Cys19, Cys11-Cys24 and Cys18-Cys31 (disulfide bonds undetermined).
Effective Concentration
1 - 100 nM
Activity
Guangxitoxin-1E is a gating modifier of KV2.1 (KCNB1, IC50 of 1 nM), KV2.2 (KCNB2, IC50 of 3 nM) and KV4.3 (KCND3, IC50 of 10-20 fold higher concentration) channels. In pancreatic β cells it enhances glucose-stimulated insulin secretion by broadening the cell action potential and enhancing calcium oscillations1, 2. The physiological modulation of KV2.1 channels during glucose-induced insulin secretion is MgATP-mediated3.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Guangxitoxin-1E is a 36 amino acid peptidyl toxin isolated from the Chilobrachys jingzhao (Chinese earth tiger) tarantula venom and belongs to the huwentoxin-1 family. Guangxitoxin-1E is a gating modifier of KV2.1 (KCNB1, IC50 of 1 nM), KV2.2 (KCNB2, IC50 of 3 nM) and KV4.3 (KCND3, IC50 of 50 nM) channels1. In pancreatic β cells, it enhances glucose-stimulated insulin secretion by broadening the cell action potential and enhancing calcium oscillations1, 2. The physiological modulation of KV2.1 channels during glucose-induced insulin secretion is MgATP-mediated3, 4. No significant effect was found on KV1.2 (KCNA2), KV1.3 (KCNA3), KV1.5 (KCNA5), KV3.2 (KCNC2), CaV1.2 (CACNA1C), CaV2.2 (CACNA1B), NaV1.5 (SCN5A), NaV1.7 (SCN9A) or NaV1.8 (SCN10A) channels1, 2.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen