Vergleich

Tityustoxin-Kalpha-ATTO Fluor-594 Europäischer Partner

ArtNr ALO-STT-360-AR-5ug
Hersteller Alomone
Menge 5 ug
Quantity options 5 ug 5 x 5 ug
Kategorie
Typ Molecules
Format Lyophilized
Applikationen FC, IF
Specific against other
Konjugat/Tag Texas Red, Rhodamine
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry
Manufacturer - Category
Proteins
Manufacturer - Targets
KV1.2 K+ channels
Manufacturer - Conjugate / Tag
ATTO-594. Maximum absorption 601 nm; Maximum fluorescence 627 nM The fluorescence is excited most efficiently in the 580 - 615 nm range. This label belongs to the class of Rhodamine dyes and can be used with fluorescent equipment typically optimized to detect Texas Red and Alexa-594. The extent of labeling is 1-3 molecules of dye per molecule of Tityustoxin-Kα.
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.
Storage Conditions
Storage as Solution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light. - Storage after Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Molecular Weight
~4900 Da
Manufacturer - Format
Lyophilized
Short description
A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594
Description
K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9 - A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Specificity

A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594

PH
7, 4
UNSPSC
12352202
Origin
Tityus serrulatus (Brazilian scorpion)
Modifications

Disulfide bonds between: Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35

Ala20 was replaced by Cysteine (bold in the sequence).

ATTO Fluor-594

Effective Concentration
0.5 - 50 nM
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1, 2.Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Tityustoxin Kα (#STT-360) is a potent and specific blocker of KV1.2 channels1, 2. It was originally isolated from the scorpion Tityus serrulatus venom2.The labeled version of the toxin, Tityustoxin-Kα-ATTO Fluor-594, has been tested in electrophysiology applications and is specially suited to experiments requiring simultaneous labeling of different markers.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen