« Zurück
Startseite /
Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )

Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )

ArtNr	PT_41855_10ug
Hersteller	Novateinbio
Menge	10 ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Purity	Greater than 95.0% as determined by SDS-PAGE.
Sequence	MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )
Similar products	Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )
Lieferbar
Description	Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
Storage/Stability	Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Purity	Greater than 95.0% as determined by SDS-PAGE.
Form	ProNGF was lyophilized from a 0.2 uM filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Expression host	Escherichia Coli.
Reagent Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence	MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Solubility	It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Manufacturers Category	Neuroscience

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern