Comparison

Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )

Item no. PT_41855_10ug
Manufacturer Novateinbio
Amount 10 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Purity Greater than 95.0% as determined by SDS-PAGE.
Sequence MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )
Similar products Pro-Nerve Growth Factor Human Recombinant ( ProNGF Human )
Available
Description
Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
Storage/Stability
Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
ProNGF was lyophilized from a 0.2 uM filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Expression host
Escherichia Coli.
Reagent Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence
MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Solubility
It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Manufacturers Category
Neuroscience

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close