Vergleich

Recombinant Mouse VEGF-A/VEGF164

ArtNr NOVP-CD73-500ug
Hersteller Novoprotein Scientific
Menge 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Konjugat/Tag Unconjugated
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIF QEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPT SESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRP KKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKN TDSRCKARQLELNERTCRCDKPRR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Vascular endothelial growth factor A,VEGF-A,Vascular permeability factor,VPF,VEGFA,VEGFA164,VEGF164
Similar products VEGF-A164
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Host
Pichia Pastoris
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
19, 27
Description
Recombinant Mouse Vascular Endothelial Growth Factor A is produced by our Yeast expression system & the target gene encoding Ala27-Arg190 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Background
Mouse Vascular endothelial growth factor (VEGF or VEGF­A), is a potent mediator of both angiogenesis & vasculogenesis in the fetus & adult. It is a member of the PDGF/VEGF growth factor family that is characterized by a cystine knot structure formed by eight conserved cysteine residues. Alternately spliced isoforms of 120, 164 & 188 aa found in mouse. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt­1) & VEGF R2 (Flk­/KDR) on endothelial cells.Although affinity is highest for binding to VEGF R1, VEGF R2 appears to be the primary mediator of VEGF angiogenic activity. VEGF is required during embryogenesis to regulate the proliferation, migration, & survival of endothelial cells.It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis.
Biological Activity
Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED50 for this effect is typically 1­4ng/mL, Corresponding to a specific activity of >= 2.5 x 105 units/mg.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ala27-Arg190

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen