« Zurück
Startseite /
Recombinant Rabbit CD40 ligand

Recombinant Rabbit CD40 ligand

ArtNr	OPCA00040-100UG
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Aging & Neurological Disorders By Cell Type Hematology Lymphoma Peptides & Proteins Recombinant Proteins Neurodegeneration Markers
Typ	Proteins Recombinant
Format	Liquid
Specific against	Rabbit (Oryctolagus cuniculus)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
Citations	Targeting HIV-1 Envelope Glycoprotein Trimers to B Cells by Using APRIL Improves Antibody Responses.Melchers M., Bontjer I., Tong T., Chung N.P., Klasse P.J., Eggink D., Montefiori D.C., Gentile M., Cerutti A., Olson W.C., Berkhout B., Binley J.M., Moore J.P., Sanders R.W.J. Virol. 86:2488-2500(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD40 ligand;TNLG8B;tumor necrosis factor ligand 8B;Tumor necrosis factor ligand superfamily member 5.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	20.2 kDa
Gene symbol	CD40LG
Gene Fullname	CD40 ligand
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Cytokine that binds to CD40/TNFRSF5. Involved in immunoglobulin class switching.
Protein name	CD40 ligand
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA00040-100UG-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern