Comparison

Recombinant Rabbit CD40 ligand

Item no. OPCA00040-100UG
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Rabbit (Oryctolagus cuniculus)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
Citations Targeting HIV-1 Envelope Glycoprotein Trimers to B Cells by Using APRIL Improves Antibody Responses.Melchers M., Bontjer I., Tong T., Chung N.P., Klasse P.J., Eggink D., Montefiori D.C., Gentile M., Cerutti A., Olson W.C., Berkhout B., Binley J.M., Moore J.P., Sanders R.W.J. Virol. 86:2488-2500(2012)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD40 ligand;TNLG8B;tumor necrosis factor ligand 8B;Tumor necrosis factor ligand superfamily member 5.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
20.2 kDa
Gene symbol
CD40LG
Gene Fullname
CD40 ligand
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Cytokine that binds to CD40/TNFRSF5. Involved in immunoglobulin class switching.
Protein name
CD40 ligand
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close