Vergleich

Recombinant human Heterogeneous nuclear ribonucleoprotein D0

ArtNr OPCA00462-100UG
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Konjugat/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSR
Citations The human HNRPD locus maps to 4q21 and encodes a highly conserved protein.Dempsey L.A., Li M.-J., DePace A., Bray-Ward P., Maizels N.Genomics 49:378-384(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ARE-binding protein AUFI,type A;AUF1;AUF1A;AU-rich element RNA binding protein 1,37kDa;AU-rich element RNA-binding protein 1;heterogeneous nuclear ribonucleoprotein D0;hnRNP D0;hnRNPD0;HNRPD;P37.
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Molecular Weight
58.3 kDa
Gene symbol
HNRNPD
Gene Fullname
heterogeneous nuclear ribonucleoprotein D
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.
Protein name
Heterogeneous nuclear ribonucleoprotein D0
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen