Comparison

Recombinant human Heterogeneous nuclear ribonucleoprotein D0

Item no. OPCA00462-100UG
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSR
Citations The human HNRPD locus maps to 4q21 and encodes a highly conserved protein.Dempsey L.A., Li M.-J., DePace A., Bray-Ward P., Maizels N.Genomics 49:378-384(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ARE-binding protein AUFI,type A;AUF1;AUF1A;AU-rich element RNA binding protein 1,37kDa;AU-rich element RNA-binding protein 1;heterogeneous nuclear ribonucleoprotein D0;hnRNP D0;hnRNPD0;HNRPD;P37.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Molecular Weight
58.3 kDa
Gene symbol
HNRNPD
Gene Fullname
heterogeneous nuclear ribonucleoprotein D
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.
Protein name
Heterogeneous nuclear ribonucleoprotein D0
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close