Vergleich

Recombinant human Basigin

ArtNr OPCA00939-100UG
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 5F7;basigin;CD147;collagenase stimulatory factor;EMMPRIN;EMPRIN;extracellular matrix metalloproteinase inducer;HAb18G;hepatoma-associated antigen;leukocyte activation antigen M6;OK;OK blood group antigen;SLC7A11;TCSF;tumor cell-derived collagenase stimulatory factor.
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
24.2 kDa
Gene symbol
BSG
Gene Fullname
basigin (Ok blood group)
Protein size
138-321 aa
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8 and SLC16A11 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
Protein name
Basigin
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen