« Back
Home /
Recombinant human Basigin

Recombinant human Basigin

Item no.	OPCA00939-100UG
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Glucose Homeostasis By Cell Type Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins Adhesion Molecule Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	5F7;basigin;CD147;collagenase stimulatory factor;EMMPRIN;EMPRIN;extracellular matrix metalloproteinase inducer;HAb18G;hepatoma-associated antigen;leukocyte activation antigen M6;OK;OK blood group antigen;SLC7A11;TCSF;tumor cell-derived collagenase stimulatory factor.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	24.2 kDa
Gene symbol	BSG
Gene Fullname	basigin (Ok blood group)
Protein size	138-321 aa
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8 and SLC16A11 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
Protein name	Basigin
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00939-100UG-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer