« Zurück
Startseite /
KLK10 Recombinant Protein (Human)

KLK10 Recombinant Protein (Human)

ArtNr	OPCA01007-100UG
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer Neurodegeneration Markers Adhesion Molecule Markers Progenitor Markers
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
Citations	The role for NES1 serine protease as a novel tumor suppressor.Goyal J., Smith K.M., Cowan J.M., Wazer D.E., Lee S.W., Band V.Cancer Res. 58:4782-4786(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	breast normal epithelial cell associated serine protease;kallikrein 10 protein 1;kallikrein 10 protein 12;kallikrein 10 protein 13;kallikrein 10 protein 2;kallikrein 10 protein 3;kallikrein 10 protein 4;kallikrein 10 protein 5;kallikrein 10 protein 7;kallikrein 10 protein 8;kallikrein 10 protein 9;kallikrein-10;NES1;normal epithelial cell-specific 1;protease serine-like 1;PRSSL1.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	30.8 kDa
Gene symbol	KLK10
Gene Fullname	kallikrein related peptidase 10
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Protein name	Kallikrein-10
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA01007-100UG-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern