« Back
Home /
KLK10 Recombinant Protein (Human)

KLK10 Recombinant Protein (Human)

Item no.	OPCA01007-100UG
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer Neurodegeneration Markers Adhesion Molecule Markers Progenitor Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
Citations	The role for NES1 serine protease as a novel tumor suppressor.Goyal J., Smith K.M., Cowan J.M., Wazer D.E., Lee S.W., Band V.Cancer Res. 58:4782-4786(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	breast normal epithelial cell associated serine protease;kallikrein 10 protein 1;kallikrein 10 protein 12;kallikrein 10 protein 13;kallikrein 10 protein 2;kallikrein 10 protein 3;kallikrein 10 protein 4;kallikrein 10 protein 5;kallikrein 10 protein 7;kallikrein 10 protein 8;kallikrein 10 protein 9;kallikrein-10;NES1;normal epithelial cell-specific 1;protease serine-like 1;PRSSL1.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	30.8 kDa
Gene symbol	KLK10
Gene Fullname	kallikrein related peptidase 10
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Protein name	Kallikrein-10
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA01007-100UG-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer