Vergleich

Phospholipase A2, Secretory, Group XII, Recombinant, Human (PLA2, sPLA2-XII)

ArtNr USB-P4074-06R-10UG
Hersteller United States Biological
Menge 10 ug
Quantity options 2 ug 10 ug
Kategorie
Typ Enzymes
Format Lyophilized
Specific against other
Purity ≥ 95% (SDS-PAGE); Ni-NTA affinity chromatography.
ECLASS 10.1 32160410
ECLASS 11.0 32160410
UNSPSC 12352204
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Molecular Biology / MB-Enzymes
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Molecular Weight
20, 6
Grade
Highly Purified
Form
Supplied as a lyophilized powder in 0.01M Tris buffer, pH 8.6.
EU Commodity Code
30021019
Description
Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of lowmolecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.

Description:
Recombinant Human Secreted Phospholipase A2-XII was produced with N-terminal His-Tag, is 20.6kD polypeptide containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues.

Amino Acid Sequence: MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPR YGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHV QACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Specificity:
The amino acid sequence of the recombinant human Secreted Phospholipase A2-XII is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-XII without signal sequence.

Applications:
Western blotting

Reconstitution:
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.

Storage:
Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Shelf Life
6 months

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen