ZMPSTE24 Rabbit pAb

ArtNr	A18593-1000uL
Hersteller	Abclonal
Menge	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	AWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGM
NCBI	ZMPSTE24
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HGPS,PRO1,FACE1,RSDM1,STE24,FACE-1,Ste24p,ZMPSTE24
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	55kDa
Background	This gene encodes a member of the peptidase M48A family. The encoded protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in this gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZMPSTE24 (NP_005848.2).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	55kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Intermediate Filaments, Ubiquitin.
Antigen Seq	AWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGM
Manufacturer - Gene ID (Human)	10269
Expected Protein Size	55kDa
Gene Symbol	ZMPSTE24

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A18593-1000uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 uL

lieferbar

Lieferung vsl. bis 02.10.2025