KIF3A Rabbit pAb

ArtNr	A6639-500uL
Hersteller	Abclonal
Menge	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Typ	Antibody Polyclonal
Applikationen	WB, IF, IP, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	RKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRR
NCBI	KIF3A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FLA10,KLP-20,KIF3A
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	80kDa
Background	Enables protein phosphatase binding activity; small GTPase binding activity; and spectrin binding activity. Involved in protein localization to cell junction and protein transport. Located in centriole and centrosome. Part of kinesin II complex. Colocalizes with spindle microtubule.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 430-699 of human KIF3A (NP_008985.3).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:100 - 1:500\|IF/ICC, 1:50 - 1:200\|IP, 1:50 - 1:200
Protein Size	80kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Motor Proteins, Immunology Inflammation, Neuroscience, Stem Cells.
Antigen Seq	RKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ
Manufacturer - Gene ID (Human)	11127
Expected Protein Size	80kDa
Gene Symbol	KIF3A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A6639-500uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 18.12.2025