« Zurück
Home /
Recombinant Human ACE2 Protein with His tag

Recombinant Human ACE2 Protein with His tag

ArtNr	RP01276-1mg
Hersteller	Abclonal
Menge	1 mg
Quantity options	1000 ug 100 ug 1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 90% by SDS-PAGE.
Sequence	QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
NCBI	ACE2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ACE2,ACEH,angiotensin-converting enzyme 2,ACEH
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	SARS-CoV-2 antigens
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.\|or This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human ACE2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln18-Ser740) of human ACE2 (Accession #Q9BYF1) fused with a 6xHis tag at the C-terminus.
Manufacturer - Cross Reactivity	For lyophilized protein : Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Gln18-Ser740
Protein Size	84.4kDa
Route	C-6xHis
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	SARS-CoV-2 antigens
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ACE2 at 2μg/mL (100 μL/well) can bind Recombinant SARS-COV-2 Spike S1 with a linear range of 0. 49-27. 83 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 05.06.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail