« Back
Home /
Recombinant Human ACE2 Protein with His tag

Recombinant Human ACE2 Protein with His tag

Item no.	RP01276-1mg
Manufacturer	Abclonal
Amount	1 mg
Quantity options	1000 ug 100 ug 1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 90% by SDS-PAGE.
Sequence	QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
NCBI	ACE2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ACE2,ACEH,angiotensin-converting enzyme 2,ACEH
Shipping condition	Cool pack
Available
Manufacturer - Category	SARS-CoV-2 antigens
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.\|or This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human ACE2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln18-Ser740) of human ACE2 (Accession #Q9BYF1) fused with a 6xHis tag at the C-terminus.
Manufacturer - Cross Reactivity	For lyophilized protein : Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Gln18-Ser740
Protein Size	84.4kDa
Route	C-6xHis
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	SARS-CoV-2 antigens
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ACE2 at 2μg/mL (100 μL/well) can bind Recombinant SARS-COV-2 Spike S1 with a linear range of 0. 49-27. 83 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 6/5/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail