Vergleich

Recombinant Human EGF Protein Europäischer Partner

ArtNr RP01502-20ug
Hersteller Abclonal
Menge 20 ug
Quantity options 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
NCBI EGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EGF,HOMG4,URG
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Growth Factor, Cell Culture related
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
1.Recombinant Human EGF Protein is produced by Pichia expression system. The target protein is expressed with sequence (Asn971-Arg1023) of human EGF (Accession #NP_001954.2) fused with no tag.
Background
Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HBEGF), epigen, and the neuregulins (NRG)-1 through -6. Members of this protein family have highly similar structural and functional characteristics. The 1207 amino acid (aa) human EGF precursor contains 9 EGF domains and 9 LDLR class B repeats. Human EGF is a 645-Da protein with 53 amino acid residues and three intramolecular disulfide bonds. EGF is a growth factor that stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid (4). Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members (5). EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Dimerization results in autophosphorylation of the receptor at specific tyrosine residues to create docking sites for a variety of signaling molecules (5, ?8). EGF seems regulated by dietary inorganic iodine and plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity.
Immunogen
Asn971-Arg1023
Route
No tag
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Growth Factor, Cell Culture related
Bioactivity
Active Recombinant Human EGF enhances AKT(Ser473) autophosphorylation in A431 cells. 10 ng/mL of Recombinant Human EGF can effectively enhance AKT(Ser473) autophosphorylation.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen