« Zurück
Startseite /
Recombinant Human Paraoxonase-2

Recombinant Human Paraoxonase-2

ArtNr	enz-300-10ug
Hersteller	ProSpec
Menge	10ug
Kategorie	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Enzymes
Typ	Enzymes
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160410
ECLASS 11.0	32160410
UNSPSC	12352204
Similar products	PON2
Lieferbar
Synonyms	Serum paraoxonase, arylesterase 2, EC 3 1 1 2, EC 3 1 8 1, PON 2, Serum aryldialkylphosphatase 2, A-esterase 2, Aromatic esterase 2
Introduction	Paraoxonase 2 (PON2) is a member of a multigene family whose genes share 65% identity at the amino acid level, and is expressed in a variety of tissues, including the pancreas. PON2 overexpression has been shown to lower the intracellular oxidative state and reduce the cells ability to oxidize LDL. PON2 is therefore implicated in the modulation of oxidative stress.
Description	Paraoxonase-2 Human Recombinant is expressed in E. coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag. The PON2 purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered clear solution.
Formulation	PON2 is supplied in PBS and 50% glycerol.
Purity	Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ.
Storage	Store at 4C if entire vial will be used within 1-2 weeks. Store, frozen at -20C for longer periods of time. Avoid multiple freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

enz-300-10ug-safety-datasheet.pdf