Vergleich

UBE2L3 His Europäischer Partner

ArtNr enz-344-10ug
Hersteller ProSpec
Menge 10 ug
Quantity options 10 ug 1 mg 50 ug
Kategorie
Typ Enzymes
Format Lyophilized
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Purity Greater than 95.0% as determined by(a) Analysis by RP-HPLC.<br />(b) Analysis by SDS-PAGE.
Sequence MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP DNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFT KKYGEKRPVD.
ECLASS 10.1 32160410
ECLASS 11.0 32160410
UNSPSC 12352204
Alias UBE2L3 His,Ubiquitin-conjugating enzyme E2 L3,EC 6 3 2 19,Ubiquitin-protein ligase L3,Ubiquitin carrier protein L3,UbcH7,E2-F1,L-UBC,UbcM4
Similar products UBE2L3 His
Lieferbar
Manufacturer - Category
ENZYMES
Storage Conditions
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2L3 should be stored at 4C between 2-7 days and for future use below -18C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Description
Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His Tag
Formulation
Lyophilized from a 0.2m filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Introduction
Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of transcription factors. The enzyme is ubiquitously expressed with high levels of expression seen in adult muscle. UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly homologous to UbcH5. It has been demonstrated to participate in the ubiquitinylation of p53, c-Fos and NF-B. UbcH7 is one of two E2s (UbcH5 being the other) with which HECT domain proteins interact with UbcH7 being able to efficiently substitute for UbcH5 in E6-AP-dependent ubiquitinylation.
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Manufacturer - Format
Sterile Filtered white lyophilized powder.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen