Vergleich

MMP9 Europäischer Partner

ArtNr enz-438-2ug
Hersteller ProSpec
Menge 2 ug
Quantity options 10 ug 1 mg 2 ug
Kategorie
Typ Enzymes
Format Liquid
Specific against Human (Homo sapiens)
Purity Greater than 95.0% as determined by SDS-PAGE.
Sequence 4.5kDa His Tag-DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDAD IVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFP FIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSA CTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVF
ECLASS 10.1 32160410
ECLASS 11.0 32160410
UNSPSC 12352204
Alias MMP9,Matrix metalloproteinase-9,MMP-9,92 kDa type IV collagenase,92 kDa gelatinase,Gelatinase B,GELB,MMP9,CLG4B
Similar products MMP 9
Lieferbar
Manufacturer - Category
ENZYMES
Storage Conditions
Store at 4C if entire vial will be used within 2-4 weeks.
Store, frozen at -20C for longer periods of time.
Please avoid freeze thaw cycles.
Description
Recombinant Human Matrix Metalloproteinase-9
Formulation
(0.57 mg/ml) MMP-9 protein is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Introduction
Matrix metalloproteinases are a family of zinc and calcium-dependent endopeptidases that break down extracellular matrix proteins. The MMP9 is secreted as a 92kDa zymogen. Cleavage of ProMMP-9 results in the active enzyme, having a molecular weight of approximately 82kDa. MMP9 is composed of the following domains: a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by the several cell types: monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells. MMP9 is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 may also play an important part in local proteolysis of the extracellular matrix and in leukocyte migration, as well as in bone osteoclastic resorption. MMP9 cleaves type IV and type V collagens into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. MMP9 can also degrade fibronectin but not laminin or Pz-peptide.
MMP9 defects may be a cause of susceptibility to intervertebral disc disease (IDD), also known as lumbar disk herniation (LDH).
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Manufacturer - Format
Sterile Filtered clear solution.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 2 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen