Vergleich

human BDNF Europäischer Partner

ArtNr ALO-B-250-25ug
Hersteller Alomone
Menge 25 ug
Quantity options 0.1 mg 0.25 mg 0.5 mg 10 ug 1 mg 1 ug 25 ug 50 ug 5 ug 5 x 1 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Applikationen WB
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR-OH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Category
Proteins
Manufacturer - Targets
p75NTR, TrkB receptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
27 kDa (dimer)
Manufacturer - Format
Lyophilized
Short description
Human Brain-Derived Neurotrophic Factor, Recombinant,  E. coli
Description
Brain-Derived Neurotrophic Factor - Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Effective Concentration
ED50 = 220 pM
Activity
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1, 2. BDNF supports the survival of many cell types3-8.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
yes
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophic growth factors, and shares high sequence homology with NGF, NT-3 and NT-4/5.1, 2 BDNF is found in neurons of the central nervous systeM It is expressed predominantly in hippocampus, cortex, and amygdaloid complex.3The synthesis of BDNF is subject to regulation by neuronal activity and specific transmitter systems.4BDNF binds to p75NTR, the neurotrophin receptor, and may initiate programmed cell death by acting through this receptor.5 Signal transduction is activated by the dimerization and autophosphorylation of the TrkB receptor.6BDNF supports the survival of primary sensory neurons, 7 retinal ganglion cells, basal forebrain cholinergic neurons, 8 and mesencephalic dopaminergic neurons in vitro.9 BDNF prevents death of cultured rat spinal motor neurons, 10 and rescues substantial numbers of motor neurons after lesioning of the neonatal sciatic or facial nerve.11 Expression is switched on in Schwann cells following peripheral nerve lesion.11 BDNF also inhibits the normal cell death of embryonic chick motor neurons.12BDNF acts in concert with other factors and neurotrophins. The biological activities of BDNF and NT-3 (neurotrophin-3) are additive, and BDNF also interacts with LIF.13The effects of BDNF on motor neurons raise the possibility that it may be useful in treating patients with motor neuropathies and Amyotrophic Lateral Sclerosis (ALS).14

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 29.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen