Vergleich

human Pleiotrophin Europäischer Partner

ArtNr ALO-P-150-10ug
Hersteller Alomone
Menge 10 ug
Quantity options 10 ug 5 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O).
Sequence MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Category
Proteins
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
15.4 kDa
Manufacturer - Format
Lyophilized
Short description
Human Pleiotrophin, Recombinant,  E. coli
Description
PTN - Human Pleiotrophin, Recombinant, E. coli
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Specificity

Human Pleiotrophin, Recombinant, E. coli

PH
7, 4
UNSPSC
12352202
Effective Concentration
EC50 = ~0.65 - 6.5 pM
Activity
Pleiotrophin is a member of the heparin-binding neurotrophic factor family. It is a developmentally regulated neurotrophic factor which promotes neurite outgrowth, axonal guidance and synaptogenesis1-4.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Sterile endotoxin free
yes
Bioassay tested
yes
Endotoxin level
<0.1 EU per 1 µg of the protein by the LAL method.
Scientific Background
Pleiotrophin (PTN), is a heparin-binding neurotrophic factor. Cells that express either PTN or PTN mRNA include osteoblasts, fetal chondrocytes, 1 astrocytes, oligodendroglia, neurons, 2 Schwann cells, 3 keratinocytes of the stratum basale, 3 and selected tumor cell lines.4, 5 The expression of PTN increases during the process of brain embryogenesis and reaches maximum levels at time of birth.The role of PTN in neurogenesis and neural plasticity has been revealed by various studies. Embryonic cortical neurons adhere to and extend neurites on PTN coated substratuM6 PTN also induces, in vitro, migration of osteoblasts. 7 PTN coated membrane enhances neuronal migration by haptotaxis.8 PTN bound to agarose beads induces clustering of acetylcholine receptors on embryonic myoblasts.9PTN is expressed in the CA1 region of rat hippocampus in an activity-dependent manner, and is suggested to be involved in the regulation of synaptic plasticity in the hippocampus.10Transfection with PTN cDNA, transforms murine 3T3 fibroblasts into cells that form extensively metastasizing tumors in nude mice.11 PTN is highly expressed in choriocarcinoma, melanoma and, prostate carcinoma. Serum PTN increase in patients with pancreatic and colon carcinomas.12After focal forebrain ischemia, PTN is expressed in astrocytes, OX-42 positive macrophages, and endothelial cells in areas of developing neovascularization.13 PTN is also deposited in senile plaques in Alzheimer's disease and Down's syndrome.14

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen