Vergleich

IP-10, human, recombinant (CXCL10) Europäischer Partner

ArtNr BNTH-CHM-330-1mg
Hersteller BIOSYNTH
Menge 1 mg
Quantity options 1 mg
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Purity Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Small inducible cytokine B10,CXCL10,10 kDa interferon-gamma-induced protein,Gamma-IP10,IP-10,chemokine (C-X-C motif) ligand 10, C7,IFI10,INP10,crg-2,mob-1,SCYB10,gIP-10,rHCXCL10
Gefahren-Info Not controlled, not hazardous for shipping
Lieferbar
Manufacturer - Applications
CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis
Manufacturer - Category
Life Sciences / Peptides and Biochemicals / Research Peptides
Shipping Temperature
No Dry Ice
Storage Conditions
-20 C
Model
IP-10 Human Recombinant (CXCL10)
Description
Introduction: Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.Description: IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.Formulation: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).Solubility: It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ -cm H2O not less than 100µ g/ml, which can then be further diluted to other aqueous solutions.Stability: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution CXCL10 should be stored at 4° C between 2-7 days and for future use below -18° C. For long term storage it is recommended to add a carrier protein (0.1% HAS or BSA).Please prevent freeze-thaw cycles.
One letter code
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen