« Zurück
Startseite /
Recombinant Mouse Killer cell lectin-like receptor 3(Klra3),partial

Recombinant Mouse Killer cell lectin-like receptor 3(Klra3),partial

ArtNr	CSB-EP720664MO-20
Hersteller	Cusabio
Menge	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTN KSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRD TGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHY SVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKK KEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARI EDIDCNIPYYCICGKKLDKFPD
Citations	Ly-49 multigene family. New members of a superfamily of type II membrane proteins with lectin-like domains. Wong S., Freeman J.D., Kelleher C., Mager D., Takei F. J. Immunol. 147:1417-1423(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	5E6; Lymphocyte antigen 49c; Short name:; Ly-49c; Nk2.1; T-cell surface glycoprotein Ly-49C; Ly-49c, Ly49C
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	27.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Receptor on natural killer (NK) cells for class I MHC.
Expression Region	70-266aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor on natural killer (NK) cells for class I MHC.
Subcellular Location	Membrane, Single-pass type II membrane protein
Gene Names	Klra3
Sequence Info	Partial
Organism	Mus musculus (Mouse)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP720664MO-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 18.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern