« Zurück
Home /
Recombinant Mouse Complement C1r-A subcomponent(C1ra)

Recombinant Mouse Complement C1r-A subcomponent(C1ra)

ArtNr	CSB-EP806535MO-100ug
Hersteller	Cusabio
Menge	100 ug
Quantity options	100 ug 1 mg 20 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse (Murine, Mus musculus)
Konjugat/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPMGYRVKLVFWQFDVEPSEGCFYDYVKISADKQTLGRFCGQLDSPLGNPPGSKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASQPNSVEEGLQPRCQHLCHNYVGGYFCSCHPGYELQKDGQSCQAECSSELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTVHLKFLDPFEIDDHQQVHCPYDQLQIYANGKNLGEFCGKQR
Citations	Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.' Bernhard O.K., Kapp E.A., Simpson R.J. J. Proteome Res. 6:987-995(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	(Complement component 1 subcomponent r-A)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight	85.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Expression Region	17-707aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names	C1ra
Sequence Info	Full Length of Mature Protein
Endotoxin	Not test.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP806535MO-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 03.07.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail