Vergleich

Recombinant Mouse Tumor necrosis factor receptor superfamily member 4/TNFRSF4/OX40

ArtNr NOVP-C1126-500ug
Hersteller Novoprotein Scientific
Menge 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Purity Greater than 95% as determined by SEC-HPLC & reducing SDS-PAGE.
Sequence VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDH TRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGS ELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCV PCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDS LDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWP RTSELPSPPTLVTPEGPHHHHHH*
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 4,TNFRSF4,OX40,CD134,Txgp1
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Description
Recombinant Mouse Tumor necrosis factor receptor superfamily member 4//TNFRSF4/OX40 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val20­Pro211) of Mouse OX40/TNFRSF4 fused with a 6His tag at the C-terminus.
Formulation
PBS, pH7.4
Background
OX40, also termed CD134 & TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival & homeostasis of effector & memory T cells. OX40 is expressed on CD4+ & CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand & CD28-B7. The interaction between OX40 & OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, & survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function & differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, & T-cell-mediated inflammatory diseases.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug).
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in distilled water.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen