Vergleich

[Novoprotein] Recombinant E. coli G/U Mismatch-Specific DNA Glycosylase/Mug (C-6His)

ArtNr NOVP-C152-1mg
Hersteller Novoprotein Scientific
Menge 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Escherichia coli (E.coli)
Host E.coli
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Dry ice Yes
Sequence MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPAN RFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLV DRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALA ILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPN PSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias G/U Mismatch-Specific DNA Glycosylase,Double-Strand-Specific Uracil Glycosylase,Mismatch-Specific Uracil DNA-Glycosylase,MUG,mug,ygjF
Similar products mug-glycosylase
Lieferbar
Shipping Temperature
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Molecular Weight
19, 74
Description
Recombinant E.coli Mug is produced by our E.coli expression system & the target gene encoding Met1-Arg168 is expressed with a 6His tag at the C-terminus.
Formulation
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 2.5mM beta-ME, 1mM PMSF, 50% Glycerol, pH 8.0.
Background
E. coli Mismatch Uracil DNA Glycosylase (Mug protein) is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3, N4-ethenocytosine & removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA & the mispaired base. The complementary strand guanine functions in substrate recognition. It is required for DNA damage lesion repair in stationary-phase cells.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met1-Arg168

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen