Vergleich

[Novoprotein] Recombinant Human C-C Motif Chemokine 4/CCL4 (C-6His)

ArtNr NOVP-C569-50ug
Hersteller Novoprotein Scientific
Menge 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLC SQPAVVFQTKRSKQVCADPSETWVQEYVYDLELNV DHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C-C Motif Chemokine 4,G-26 T-Lymphocyte-Secreted Protein,HC21,Lymphocyte Activation Gene 1 Protein,LAG-1,MIP-1-Beta(1-69),Macrophage Inflammatory Protein 1-Beta,MIP-1-Beta,PAT 744,Protein H400,SIS-Gamma,Small-Inducible Cytokine A4,T-Cell Activation Protein 2,ACT-2,CCL4,LAG1,MIP1B,SCYA4
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
8, 87
Description
Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system & the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5.
Background
C-C Motif Chemokine 4 (CCL4) is a secreted protein which belongs to the intercrine beta (chemokine CC) family. CCL4 is a chemoattractant for natural killer cells, monocytes & a variety of other immune cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, & simian immunodeficiency virus (SIV). The processed form CCL4 (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 & to inhibit the CCR5-mediated entry of HIV-1 in T-cells. CCL4 (3-69) is also a ligand for CCR1 & CCR2 isoform B.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen