Vergleich

Recombinant Human CXCL6 (C-6His)

ArtNr NOVP-C598-50ug
Hersteller Novoprotein Scientific
Menge 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAG PQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKIL DSGNKKNVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C-X-C Motif Chemokine 6,Chemokine Alpha 3,CKA-3,Granulocyte Chemotactic Protein 2,GCP-2,Small-Inducible Cytokine B6,CXCL6,GCP2,SCYB6
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Target Proteins & Cytokines / Cytokines
Manufacturer - Conjugate / Tag
C-6His
Shipping Temperature
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below.
Storage Conditions
Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days. Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months.
Molecular Weight
9.35 KDa
Description
Recombinant Human C-X-C Motif Chemokine 6 is produced by our Mammalian expression system and the target gene encoding Gly38-Asn114 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, 1mM EDTA, pH 7.4.
Shelf Life
24 Months

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen