« Zurück
Startseite /
[Novoprotein] Recombinant Mouse Probable Carboxypeptidase PM20D1/PM20d1 (C-6His)

[Novoprotein] Recombinant Mouse Probable Carboxypeptidase PM20D1/PM20d1 (C-6His)

ArtNr	NOVP-C768-10ug
Hersteller	Novoprotein Scientific
Menge	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Neuroscience Aging & Neurological Disorders Peptides & Proteins Cardiovascular Research Heart Failure Myocardial Infarction Enzymes
Typ	Proteins Recombinant
Format	Liquid
Specific against	Mouse (Murine, Mus musculus)
Host	Human
Konjugat/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	STGPRSRENRGASRIPSQFSEEERVAIKEALKGAI QIPTVSFSHEESNTTALAEFGEYIRKAFPTVFHSS LVQHEVVAKYSHLFTIQGSDPSLQPYMLMAHIDVV PAPEEGWEVPPFSGLERNGFIYGRGALDNKNSVMA ILHALELLLIRNYSPKRSFFIALGHDEEVSGEKGA QKISALLQARGVQLAFLVDEGSFILEGFIPNLEKP VAMISVTEKGALDLMLQVNMTPGHSSAPPKETSIG ILS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Probable carboxypeptidase PM20D1,Peptidase M20 domain-containing protein 1,Pm20d1
Lieferbar
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	54, 2
Description	Recombinant Mouse PMKase is produced by our Mammalian expression system & the target gene encoding Ser25-Leu503 is expressed with a 6His tag at the C-terminus.
Formulation	Supplied as a 0.2 um filtered solution of PBS, pH7.4.
Background	Probable carboxypeptidase PM20D1(PM20d1) is a secreted protein & belongs to the peptidase M20A family.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Ser25-Leu503

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

NOVP-C768-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 18.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern