Vergleich

[Novoprotein] Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1

ArtNr NOVP-CB75-50ug
Hersteller Novoprotein Scientific
Menge 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGS VLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGC SSQALQQTQCLSQLHSGLCLYQGLLQALSGISPAL APTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQ SAMPAFTSAFQRRAGGVLAISYLQGFLETARLALH HLA
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Granulocyte colony-stimulating factor,Csf3,G-CSF
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
18, 8
Description
Recombinant Mouse Granulocyte Colony-Stimulating Factor is produced by our Mammalian expression system & the target gene encoding Val31-Ala208 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
Granulocyte colony-stimulating factor (G-CSF) is a growth factor & an essential cytokine which belongs to the IL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, & function of 2 related white cell populations of the blood, the granulocytes & the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to the cytokine receptor type I family depends on the interaction of alpha-helical motifs of the former & two fibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have been demonstrated to improve cardiac function & perfusion in myocardial infarction. & it was initially evaluated as a stem cell mobilizer & erythropoietin as a cytoprotective agent.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen