Vergleich

Recombinant Human Ephrin B Receptor 1/EphB1 (C-Fc)

ArtNr NOVP-CD11-10ug
Hersteller Novoprotein Scientific
Menge 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Konjugat/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence MEETLMDTRTATAELGWTANPASGWEEVSGYDENL NTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYT EMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIA TKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMK VNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVF FKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIP NAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPE NSV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Ephrin Type-B Receptor 1,ELK,EPH Tyrosine Kinase 2,EPH-Kike Kinase 6,EK6,hEK6,Neuronally-Expressed EPH-Related Tyrosine Kinase,NET,Tyrosine-Protein Knase Receptor EPH-2,EPHB1,ELK,EPHT2,HEK6,NET
Similar products EPHB1
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
85, 5
Description
Recombinant Human Ephrin B Receptor 1 is produced by our Mammalian expression system & the target gene encoding Met18-Pro540 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
Ephrin Type-B Receptor 1 (EPHB1) is a single-pass type I membrane protein that belongs to the Ephrin-B family of receptor tyrosine kinases involved in the development of embryonic nervous & vascular systems. EPHB1 contains two fibronectin type-III domains, one protein kinase domain & one Sterile Alpha Motif (SAM)domain. EPHB1 is able to stimulate fibroblast motility on extracellular matrix in a kinase-dependent manner, which is also correlated with its association with Grb7, an adaptor molecule implicated in the regulation of cell migration. It binds to Ephrin-B1, Ephrin-B2 & Ephrin-B3. EPHB1 plays an important roles in diverse biological processes including nervous system development, angiogenesis, & neural synapsis formation & maturation & may be involved in cell-cell interactions in the nervous system.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met18-Pro540

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen