Vergleich

Recombinant Mouse VEGF-D/PIGF (C-6His)

ArtNr NOVP-CD18-500ug
Hersteller Novoprotein Scientific
Menge 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Mouse (Murine, Mus musculus)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Dry ice Yes
Sequence FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKT TNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYIS KQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPR HPYSVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Vascular endothelial growth factor D,c-Fos-induced growth factor,FIGF,VEGFD,
Similar products VEGFD
Lieferbar
Shipping Temperature
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Molecular Weight
13, 1
Description
Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system & the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus.
Formulation
Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
Mouse vascular endothelial growth factor D, (VEGFD) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. VEGFD is a secreted protein & highly expressed in fetal & adult lung. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind & activate VEGFR-2 & VEGFR-3 receptors. The structure & function of this protein is similar to VEGFC. VEGFD is growth factor which active in angiogenesis, lymphangiogenesis, & endothelial cell growth, stimulating their proliferation & migration & also has effects on the permeability of blood vessels.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Phe98-Ser206

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen