« Zurück
Startseite /
Recombinant Human Growth Hormone-Releasing Factor/GHRF/Somatoliberin (C-Fc)

Recombinant Human Growth Hormone-Releasing Factor/GHRF/Somatoliberin (C-Fc)

ArtNr	NOVP-CD19-10ug
Hersteller	Novoprotein Scientific
Menge	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	Human
Konjugat/Tag	Fc
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQ DIMSRQQGESNQERGARARLVDDIEGRMDEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLD
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Somatoliberin,Growth hormone-releasing factor,Somatocrinin,Somatorelin,Growth hormone-releasing hormone,GHRH,GHRF
Similar products	GHRH
Versandbedingung	Raumtemperatur
Lieferbar
Shipping Temperature	The product is shipped at ambient temperature.
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight	33, 4
Description	Recombinant Human Somatoliberin is produced by our Mammalian expression system & the target gene encoding Pro21-Leu75 is expressed with a Fc tag at the C-terminus.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background	Growth-hormone-releasing hormone (GHRH) is a releasing hormone for growth hormone. It is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH first appears in the human hypothalamus between 18 & 29 weeks of gestation, which corresponds to the start of production of growth hormone & other somatotropes in fetuses. GRF is released by the hypothalamus & acts on the adenohypophyse to stimulate the secretion of growth hormone.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Pro21-Leu75

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 05.03.2026

Express-Lieferung: 17 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern