Vergleich

Recombinant Mouse Lymphotoxin beta Receptor/LTBR/TNFRSF3/TNFRrp (C-Fc)

ArtNr NOVP-CD78-10ug
Hersteller Novoprotein Scientific
Menge 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Konjugat/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRC PPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLST CQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSC VYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDV NCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAA PGTSYSDTICKNPPEPVDDIEGRMDEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 3,Lymphotoxin-beta receptor,Ltbr,Tnfcr,Tnfrsf3
Similar products TNFRSF3
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
48, 7
Description
Recombinant Mouse Lymphotoxin beta Receptor is produced by our Mammalian expression system & the target gene encoding Ser28-Pro218 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
It is a single-pass type I membrane protein & contains 4 TNFR-Cys repeats. The protein is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial & myeloid lineages, but not on T & B lymphocytes. The protein is the receptor for the heterotrimeric lymphotoxin containing LTA & LTB, & for TNFS14/LIGHT. It promotes apoptosis via TRAF3 & TRAF5 & may play a role in the development of lymphoid organs. The encoded protein & its ligand play a role in the development & organization of lymphoid tissue & transformed cells. Activation of the encoded protein can trigger apoptosis. Not only does the TNFRSF3 help trigger apoptosis, it can lead to the release of the cytokine interleukin 8. Overexpression of TNFRSF3 in Human Cells cells increases IL-8 promoter activity & leads to IL-8 release. TNFRSF3 is also essential for development & organization of the secondary lymphoid organs & chemokine release.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ser28-Pro218

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen