« Zurück
Startseite /
Recombinant Human Izumo Sperm-Egg Fusion Protein 4/ IZUMO4 (C-Fc)

Recombinant Human Izumo Sperm-Egg Fusion Protein 4/ IZUMO4 (C-Fc)

ArtNr	NOVP-CD94-50ug
Hersteller	Novoprotein Scientific
Menge	50 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	Human
Konjugat/Tag	Fc
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	HGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSG ALLTDWSDDTMKELHLAIPAKITREKLDQVATAVY QMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNA IIESRIDCQHRCGIFQYETISCNNCTDSHVACFGY NCESSAQWKSAVQGLLNYINNWHKQDTSMSLVSPA LRCLEPPHLANLTLEDAAECLKQHVDDIEGRMDEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Sperm 22 kDa protein c113,IZUMO4,C19orf36,UNQ831/PRO1758
Versandbedingung	Raumtemperatur
Lieferbar
Shipping Temperature	The product is shipped at ambient temperature.
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight	50, 1
Description	Recombinant Human IZUMO4 is produced by our Mammalian expression system & the target gene encoding His16-His214 is expressed with a Fc tag at the C-terminus.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background	Izumo sperm-egg fusion protein 4 is a sperm membrane protein which plays a key role in the fusion in the mouse. IZUMO4 has an N-terminal domain with significant homology to the N-terminal domain of Izumo.It belongs to the Izumo family . Izumo 4 is a soluble protein expressed in the testis & in other tissues. Izumo domain possesses the ability to form dimers, whereas the transmembrane domain or the cytoplasmic domain or both of Izumo 1 are required for the formation of multimers of higher order.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	His16-His214

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern