« Zurück
Startseite /
[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 6/CXK6 (N-6His)

[Novoprotein] Recombinant Human Cyclin-Dependent Kinase 6/CXK6 (N-6His)

ArtNr	NOVP-CF11-10ug
Hersteller	Novoprotein Scientific
Menge	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Sarcoma Peptides & Proteins Cell Biology Cell Status Proliferation Enzymes By Organ Bladder Cancer
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	MGSSHHHHHHSSGLVPRGSHMEKDGLCRADQQYEC VAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTG EEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTV SRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTS SGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEV LLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDV DQL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cyclin-Dependent Kinase 6,Cell Division Protein Kinase 6,Serine/Threonine-Protein Kinase PLSTIRE,CDK6,CDKN6
Similar products	CDK6
Lieferbar
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	39, 1
Description	Recombinant Human Cyclin-Dependent Kinase 6 is produced by our E.coli expression system & the target gene encoding Met1-Ala326 is expressed with a 6His tag at the N-terminus.
Formulation	Supplied as a 0.2 um filtered solution of 50mM Tris, 100mM NaCl, 20% Glycerol, 5mM DTT, pH 8.0.
Background	Cyclin-Dependent Kinase 6 (CDK6 belongs to the CMGC Ser/Thr protein kinase family & CDC2/CDKX subfamily. CDK6 is expressed in many tissues & contains one protein kinase domain. This cyclin forms a complex with & functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. Mutations & overexpression of CDK6, which alters cell cycle progression, are observed frequently in a variety of tumors & may contribute to tumorigenesis.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Met1-Ala326

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

NOVP-CF11-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern