« Zurück
Startseite /
[Novoprotein] Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)

[Novoprotein] Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)

ArtNr	NOVP-CF59-500ug
Hersteller	Novoprotein Scientific
Menge	500 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Oncology Neuroscience Neuroinflammation Neural Mitochondrial Function Protein Aggregation, Clearance & Misfolding By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Cell Biology Cell Status Autophagy Enzymes
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Dry ice	Yes
Sequence	MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQG VPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV QRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRV DLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGR SIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLT LTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFF KCGAHPTSDKETSVALHLIATNSRNITCITCTDVR SPV
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	E3 Ubiquitin-Protein Ligase Parkin,Parkinson Juvenile Disease Protein 2,Parkinson Disease Protein 2,PARK2,PRKN
Similar products	PARK2
Lieferbar
Shipping Temperature	The product is shipped on dry ice/ice packs.
Storage Conditions	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Molecular Weight	43, 4
Description	Recombinant Human Parkinson Juvenile Disease Protein 2 is produced by our E.coli expression system & the target gene encoding Met1-Lys387 is expressed with a 6His tag at the C-terminus.
Formulation	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, 20% Glycerol, pH7.4.
Background	E3 Ubiquitin-Protein Ligase Parkin (PARK2) belongs to the RBR family & Parkin subfamily. PARK2 is expressed in the heart, testis, skeletal muscle, with high expression levels found in the brain including the substantianigra. PARK2 is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. The mutations of gene encoding this protein will result in Parkinson disease & autosomal recessive juvenile Parkinson disease.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Met1-Lys387

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern