Human IL1RN

ArtNr	NOVP-CG62-50ug
Hersteller	Novoprotein Scientific
Menge	50 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer
Typ	Proteins
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95% as determined by SEC-HPLC & reducing SDS-PAGE.
Sequence	GHMRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNV NLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAME ADQPVSLTNMPDEGVMVTKFYFQEDE*
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hyaluronidase-1,Hyal-1,Hyaluronoglucosaminidase-1,Lung Carcinoma Protein 1,LuCa-1,HYAL1,LUCA1
Similar products	IL1RN
Versandbedingung	Raumtemperatur
Lieferbar
Shipping Temperature	The product is shipped at ambient temperature.
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.
Description	Recombinant Human Interleukin-1 Receptor Antagonist Protein/IL-1RN is produced with our E. coli expression system. The target protein is expressed with sequence (Arg26-Glu177) of Human IL1RN.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4
Background	Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune & chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 & IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble & intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug).
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in 2X PBS. Please aliquot the reconstituted solution.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern