« Zurück
Startseite /
Recombinant E. coli 4'-Phosphopantetheinyl Transferase ACPS (C-6His)

Recombinant E. coli 4'-Phosphopantetheinyl Transferase ACPS (C-6His)

ArtNr	NOVP-CH14-10ug
Hersteller	Novoprotein Scientific
Menge	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Enzymes
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Escherichia coli (E.coli)
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	AILGLGTDIVEIARIEAVIARSGDRLARRVLSDNE WAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNG LAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVAN MHVTLADERHYACATVIIESLEHHHHHH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	4'-phosphopantetheinyl transferase AcpS,acpS,dpj
Versandbedingung	Raumtemperatur
Lieferbar
Shipping Temperature	The product is shipped at ambient temperature.
Storage Conditions	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight	15, 1
Description	Recombinant E.coli 4'-phosphopantetheinyl transferase AcpS is produced by our E.coli expression system & the target gene encoding Ala2-Ser126 is expressed with a 6His tag at the C-terminus.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH8.0.
Background	Holo-[acyl-carrier-protein] synthase is an enzyme that belongs to the P-Pant transferase superfamily.AcpS family.It transfers the 4'-phosphopantetheine moiety from coenzyme A to the 'Ser-36' of acyl-carrier-protein.It catalyzes the chemical reaction: CoA-[4'-phosphopantetheine] + apo-acyl carrier protein adenosine 3', 5'-bisphosphate + holo-acyl carrier protein. This enzyme participates in pantothenate & coa biosynthesis.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length	Ala2-Ser126

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 05.03.2026

Express-Lieferung: 17 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern