Vergleich

[Novoprotein] Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein/OASLOASL (C-6His)

ArtNr NOVP-CH76-500ug
Hersteller Novoprotein Scientific
Menge 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host E.coli
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Dry ice Yes
Sequence MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLD AVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSF GNGTVLRSTREVELVAFLSCFHSFQEAAKHLEHHH HHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 2'-5'-oligoadenylate synthase-like protein,2'-5'-OAS-related protein,2'-5'-OAS-RP,59 kDa 2'-5'-oligoadenylate synthase-like protein,Thyroid receptor-interacting protein 14,TR-interacting protein 14,TRIP-14,p59OASL,OASL,TRIP14
Similar products OASL
Lieferbar
Shipping Temperature
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Molecular Weight
12, 6
Description
Recombinant Human OASL is produced by our E.coli expression system & the target gene encoding Met1-His100 is expressed with a 6His tag at the C-terminus.
Formulation
Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
2'-5'-oligoadenylate synthase-like protein (OASL) contains 2 ubiquitin-like domains, & belongs to the 2-5A synthase family. The ubiquitin-like domains are essential for its antiviral activity. OASL can be induced by type I interferon (IFN) & viruses, & expressed in most tissues such as primary blood Leukocytes & other hematopoietic system tissues, colon, stomach & to some extent in testis. OASL can specifically interacts with the ligand binding domain of the thyroid receptor (TR) without the presence of thyroid hormone. It does not have 2'-5'-OAS activity, but can bind double-stranded RNA. It also displays antiviral activity against encephalomyocarditis virus (EMCV) & hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met1-His100

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen