« Zurück
Startseite /
ZNHIT1 Recombinant Protein

ZNHIT1 Recombinant Protein

ArtNr	PRS-92-196-0.05mg
Hersteller	ProSci
Menge	0.05 mg
Kategorie	Oncology Neuroscience Neural Lineage Markers By Cell Type Blastoma Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation By Organ Lung Cancer Bladder Cancer Breast Cancer Glial Cell Markers
Typ	Proteins Recombinant
Format	Liquid
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice	Yes
Sequence	MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
NCBI	ZNHIT1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	inc finger HIT domain-containing protein 1, cyclin-G1-binding protein 1, zinc finger protein subfamily 4A member 1, p18 hamlet, CGBP1, ZNFN4A1, ZNHIT1
Lieferbar
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag	N-6 His tag
Storage Conditions	Store at -20°C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight	19.6 kD
Background	ZNHIT1 belongs to the ZNHIT1 family and contains one HIT-type zinc finger. It can be phosphorylated on Thr by MAPK11 or MAPK14. ZNHIT1 is a component of the chromatin-remodeling SRCAP complex, which is composed of at least SRCAP, DMAP, RUVBL1, RUVBL2, ACTL6A, YEATS4, ACTR6 and ZNHIT1. ZNHIT1 may play a role in p53-mediated apoptosis induction.
Buffer	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name	zinc finger HIT-type containing 1
NCBI Organism	Homo sapiens
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 06.11.2025

Express-Lieferung: 27 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern