« Back
Home /
ZNHIT1 Recombinant Protein

ZNHIT1 Recombinant Protein

Item no.	PRS-92-196-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Neuroscience Neural Lineage Markers By Cell Type Blastoma Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation By Organ Lung Cancer Bladder Cancer Breast Cancer Glial Cell Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice	Yes
Sequence	MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
NCBI	ZNHIT1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	inc finger HIT domain-containing protein 1, cyclin-G1-binding protein 1, zinc finger protein subfamily 4A member 1, p18 hamlet, CGBP1, ZNFN4A1, ZNHIT1
Available
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag	N-6 His tag
Storage Conditions	Store at -20°C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight	19.6 kD
Background	ZNHIT1 belongs to the ZNHIT1 family and contains one HIT-type zinc finger. It can be phosphorylated on Thr by MAPK11 or MAPK14. ZNHIT1 is a component of the chromatin-remodeling SRCAP complex, which is composed of at least SRCAP, DMAP, RUVBL1, RUVBL2, ACTL6A, YEATS4, ACTR6 and ZNHIT1. ZNHIT1 may play a role in p53-mediated apoptosis induction.
Buffer	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name	zinc finger HIT-type containing 1
NCBI Organism	Homo sapiens
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 11/6/2025

Express Delivery: Save 27 days

Compare

Add to wishlist

Get an offer