Vergleich

Recombinant Human R-spondin-1/RSPO1 Protein Europäischer Partner

ArtNr RP00071-200ug
Hersteller Abclonal
Menge 200 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI R-spondin-1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RSPO1,CRISTIN3,RSPO
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
26.44 kDa
Description
Recombinant Human R-spondin-1/RSPO1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-Spondin1 (Accession #NP_001033722.1) fused with a 6×His tag at the C-terminus.
Background
This protein is a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Arg31-Ala263
Route
C-His
Manufacturer - Research Area
Cytokines & Cytokine receptors
Revised name
CRISTIN3, RSPO
Antigen Seq
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Bioactivity
1. Measured by its ability to enhance Cyclin D1 expression in HCT116 human colon adenocarcinoma cells. 0. 1-10ng/mL of Recombinant Human RSPO1 can effectively enhance Cyclin D1 expression.|2. The intestinal crypts of mice were cultured in organoid culture medium containing factor combinations (100 ng/mL Noggin, Cat. RP01237 + 500 ng/mL R-spindin-1, Cat. RP00071) derived from ABclonal for144 hours, intestinal organoids were formed. (Customer Feedback Data)|3. Recombinant Human R-Spondin 1 protein stimulated Wnt signal pathway with Wnt-3a protein in HEK293T cells. After 6 hours, the stimulation when adding 300 ng/mL of R-Spondin-1 reached highest effect. Compared with only Wnt-3a stimulation, the Wnt signaling pathway was enhanced 3. 1-fold after adding 300 ng/mL R-Spondin 1.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
26.44 kDa
Gene Symbol
R-spondin-1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 02.10.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen