Recombinant Human SLAMF7/CRACC/CD319 Protein

< 0.1 EU/μg of the protein by LAL method.

ice pack

49.18 kDa

SLAM family member 7 (SLAMF7), also known as CRACC, CD319, CD2-like receptor-activating cytotoxic cells, and CS1, is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells but not in promyelocytic, B-cell lines, or T-cell lines. In human NK cells, activated SLAMF7 transmits signals following association with the adaptor protein EAT-2 . In the absence of EAT-2, SLAMF7 potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.

Ser23-Met226

Immune Checkpoint, Bio-Markers & CD Antigens, Biosimilar Drug Targets

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

SLAMF7/CD319