Vergleich

Recombinant Human Retinol-binding protein 4/PRBP Protein Europäischer Partner

ArtNr RP00274-20ug
Hersteller Abclonal
Menge 20 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 97% by SDS-PAGE.
Sequence ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
NCBI Retinol-binding
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias MCOPCB10,RDCCAS,RBP4,RDCCAS
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
21.91 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human Retinol-binding protein 4/PRBP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu19-Leu201) of human RBP4 (Accession #NP_006735.2) fused with a 6×His tag at the C-terminus.
Background
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Glu19-Leu201
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human RBP4 Protein at 2 μg/mL (100 μL/well) can bind RBP4 Rabbit mAb with a linear range of 0. 12-2. 4 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
21.91 kDa
Gene Symbol
Retinol-binding

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen