« Zurück
Startseite /
Recombinant Human CD3 epsilon Protein

Recombinant Human CD3 epsilon Protein

ArtNr	RP00601-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	100 ug 10 ug 50 ug
Kategorie	Oncology By Cell Type Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE
Sequence	NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
NCBI	CD3E
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD3e,CD3E,T3E,FLJ18683,TCRE,CD3-epsilon,IMD18
Lieferbar
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	36.1 kDa
Description	Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126) of Human CD3 epsilon (Accession #P07766) fused with a C-hFc tag at the C-terminus.
Background	T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Asp23-Asp126(C119S, C122S)
Route	C-hFc
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq	DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVSENSMEMD
Bioactivity	Measured by its binding ability in a functional ELISA. When Recombinant Human CD28/TP44 Fc Chimera is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Human B7-1/CD80 that produces 50% of the optimal binding response is approximately 0. 05-0. 3 μg/mL.
Protein Formulation	Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size	36.1 kDa
Gene Symbol	CD3E

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00601-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern