ArtNr |
RP00613-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Quantity options |
1000 ug
10 ug
500 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Rat (Rattus norvegicus) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
NCBI |
SCF/Stem Cell Factor |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Kit ligand,Hematopoietic growth factor KL,Mast cell growth factor,MGF,Steel factor,Stem cellfactor,SCF |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Category |
Cytokines & Cytokine Receptors |
Shipping Temperature |
ice pack |
Storage Conditions |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Availability |
Inquiry before order |
Manufacturer - Additional Information |
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Rat SCF/Stem Cell Factor Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln26-Ala189) of rat SCF/Stem Cell Factor (Accession #P21581) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus. |
Background |
Stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role inthe regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mastcell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate severalsignaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit ofphosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmitsignals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1.KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. |
Immunogen |
Gln26-Ala189 |
Route |
C-6xHis |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Cytokines & Cytokine Receptors |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.